DPCstruct | MC21323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 183 ± 14 aa |
| Standard deviation of domain lengths | 13.63 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 68.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835RC53 | 496-672 | YEKETAAGKQAESEKGTKLMLLSSRMFLTTAQKLFGFDVMAHQARSSTNRHDELRIGNACELLFACSREFMARKSYQLDIMAHPMWR… |
| A0A6J0M0U8 | 2-174 | EVPSCAPTIQQETSLRSFLSNSSDFISYAENLFDFNTNTNRSQEKTCQDRDSNVISDQRLALDFAKEVARRRSLLLITEPTCLLRSS… |
| A0A6I9SNJ4 | 880-1052 | None |
| Q1PEM3 | 212-394 | None |
| A0A7C9ALR1 | 105-302 | None |
| A0A426YTD5 | 29-209 | None |
| A0A7J0FEM4 | 645-819 | None |
| A0A4S8I9Q7 | 561-775 | None |
| A0A022QYX0 | 565-740 | None |
| A0A804JGK4 | 622-802 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.