DPCstruct | MC21321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 64 ± 10 aa |
| Standard deviation of domain lengths | 10.13 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 73.21 |
| Pfam Score | 96.44 |
| Assigned Pfam label(s) | CL0221- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M0QYK5 | 1-58 | MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNT |
| A0A6J0LVW7 | 2-55 | AEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRP |
| A0A4P1RJF2 | 1-70 | None |
| A0A367J7B1 | 1-60 | None |
| A0A6J1Y7D7 | 2-71 | None |
| A0A402F455 | 1-68 | None |
| A0A5N6KGU1 | 476-561 | None |
| B5FZ97 | 1-40 | None |
| G3HNW3 | 1-66 | None |
| A0A4U1F989 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.