DPCstruct | MC21320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 180 ± 25 aa |
| Standard deviation of domain lengths | 24.71 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 34.76 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | CL0167- PF09741 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182YSX2 | 4-165 | TTYWTDLFVRHFLFQSEPEHSIDCDDLLFFVRKKHIKGSSRAMPRYETEIEVFRKDSRKLPIGDPDVDWEETVYLNLVIHQFNYTLT… |
| A0A6J0LUN9 | 12-185 | TSVDEQEASDVEMDSNFWHGVFDVYFVRCMESRRRQDDDLLFFVRKLSCKSYGLTENEDAPAPYFVRRWAPKLDVLLGESLAEVDWR… |
| M8AAZ6 | 1-217 | None |
| A0A3B5M2S3 | 19-183 | None |
| A0A0X3PKF8 | 27-177 | None |
| A0A369S7I3 | 12-231 | None |
| A0A1Y1LJQ8 | 4-201 | None |
| A0A368G4I8 | 20-214 | None |
| A0A1D1YG87 | 20-208 | None |
| T1FV44 | 80-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.