DPCstruct | MC21319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 378 ± 52 aa |
| Standard deviation of domain lengths | 51.69 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 67.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 40.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N7KEI4 | 1-358 | QHDGDLSFREAWYHLSDADYPIKHDADRLPSPLVADLNGDGKPEVLIPTHDAKIQVLQPHPRPSPDDASFHDARLMADVSLLPSNVR… |
| A0A6J0LTY6 | 1-343 | MRKRDLAILMLSGFAIFFTLQHEGDFAFKEAWFHLYDDYPVKHESDRLPPPLVADLNGDGKKEVLVATNDAKIQVLEPHSRRVDEGF… |
| M4D8R1 | 21-375 | None |
| A0A830I1J0 | 54-456 | None |
| C1E2I0 | 92-601 | None |
| A0A5N6Q436 | 428-795 | None |
| A0A1R3GFW4 | 577-1017 | None |
| A0A1X7THY4 | 10-349 | None |
| A0A250XFX1 | 1-355 | None |
| B9T4Y7 | 374-730 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.