DPCstruct | MC21317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 112 ± 24 aa |
| Standard deviation of domain lengths | 24.21 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 65.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 44.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9JT15 | 15-100 | QSFSSDSLERQQFYPPGRIMHMVAMPPTHADPDDPVATDECSVGIYETPRDLYSKIRLSNTMINDHYMPMYKKMMEILIEKFAKDE |
| A0A446UUS9 | 99-198 | KGGGKEKQKESPSAPALRQLFPPGRIIHMVAQPSPDPNPGEGTSSKEAVSIYETPRDLYGKIRLAPNMIDEHYMPSYISTMESLLEQ… |
| A0A835IBV3 | 2-89 | None |
| A0A5B6W8I6 | 254-395 | None |
| A0A804RMA7 | 21-134 | None |
| A0A484NGT9 | 2-170 | None |
| A0A445MIH6 | 90-189 | None |
| A0A6A2YCY5 | 172-283 | None |
| A0A068TR85 | 204-342 | None |
| B9T3A3 | 364-515 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.