DPCstruct | MC21316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 79 ± 10 aa |
| Standard deviation of domain lengths | 10.19 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 42.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3V2M5 | 1-75 | PLGLDVETAAQSIIKVANANMADAIRLISIRKGHDPRDFALVGFGGAGPLHAAYLAKDLGIPTVIIPPHPGVTSA |
| A0A357MPN6 | 8-82 | PLGMDADRAASAIVDVAVADMAGAIRLISIEKGHDPRDFALMPFGGAGPLHAVAIARELGLPRVLVPRFPGLTSA |
| A0A7J3ZC68 | 132-193 | None |
| T0BL36 | 283-356 | None |
| A0A3D3T3U2 | 198-279 | None |
| A0A7Y5XTI0 | 18-101 | None |
| A0A1R3I3H9 | 343-450 | None |
| E3JRU0 | 105-203 | None |
| A0A7J6RKB0 | 2-76 | None |
| A0A1I8GUT3 | 2-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.