DPCstruct | MC21314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 94 ± 6 aa |
| Standard deviation of domain lengths | 6.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 54.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9JLM4 | 1-85 | MREAYVLFKDGGDPEKLVSNFSSRSDGEVFYSSLYAGLYYEAQKDADMAKSHIVTACKSPYGSRSGDYMASLAFVHCQCRNWNLE |
| A0A6P5H270 | 89-183 | LEVGRDPRPIMRDTYLMFRDAGDPEKLVSTFSRGRENEYFYSSLYAGLFYESQNDMDSSKHHILAACKSPYGLRSDDYMASLARVHC… |
| A0A484M8T8 | 85-175 | None |
| A0A5N5KG00 | 553-647 | None |
| I0YVT8 | 123-218 | None |
| A0A388KLI4 | 338-448 | None |
| A0A443PTY0 | 1-95 | None |
| A9TX28 | 104-194 | None |
| A0A7J7D0Y2 | 267-357 | None |
| A0A2P6TL70 | 588-680 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.