DPCstruct | MC21310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3 |
|---|---|
| Mean domain length (aa) | 46 ± 1 aa |
| Standard deviation of domain lengths | 1.25 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 96.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 43.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2YJM8 | 4-49 | ASNIIFSNGELDPWKDGGVLHDLSPTLVALLVEEGAHHLDLRGSNP |
| A0A453T5E7 | 11-54 | SNIIFSNGMRDPWSRGGVLKNISSSIIALVTENGAHHLDFRSAT |
| A0A3L8D9J1 | 47-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.