DPCstruct | MC2131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 107 ± 6 aa |
| Standard deviation of domain lengths | 6.00 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S3XLW7 | 3-101 | WGLGTPNLPKLGARAILQRGYVDFLGDRAGMYGEPDEAWRAECDTVLPHFLRELTKMAKAYQICTNMDEVFRLEHKGWVCEASPRRS… |
| A0A4U1AH67 | 22-124 | LQWGYFFPTSSQTGVGARMILDRYSLGYVNGRVAWMGNNQDLDQQTANKCVEIKLADKLYQFMKKNGIISSSADMIFGETDGYRMLA… |
| A0A2E3MYP3 | 28-135 | None |
| A0A229S472 | 12-123 | None |
| A0A735RKI0 | 1-116 | None |
| A0A3R7A608 | 51-168 | None |
| A0A244BSF2 | 1-105 | None |
| A0A7Z3YG04 | 22-136 | None |
| A0A3D1UZ65 | 9-108 | None |
| A0A7Z9UN91 | 2-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.