DPCstruct | MC21308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 396 ± 48 aa |
| Standard deviation of domain lengths | 47.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 67.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 29.28 |
| Pfam Score | 56.25 |
| Assigned Pfam label(s) | CL0595- PF00517- PF13804 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F7Z9G6 | 112-443 | LIQAVTWMDNPIEVYVNNSAWAPGPTGDRGPAQPEEEGMMMNISIGYYYPLICLEKVPGYLMPTTQNWLVEAPTVSATSRFTYHMVS… |
| W5NTJ9 | 6-365 | NEEVDPGSSNLTIAVEGIPLCIGGHPFCLSTKEHSHHSYNTWGVKYNNYHFATFTVLVSTRGFSTSTEPIDIHNGKHMSLCPVNFFV… |
| Q07DS3 | 1-415 | None |
| W5PPK0 | 50-435 | None |
| P63135 | 872-1287 | None |
| A0A4W2E365 | 1-360 | None |
| A0A7N9CBJ8 | 37-500 | None |
| A0A286XB25 | 61-518 | None |
| A0A4W2FWD0 | 251-649 | None |
| A0A811YSV6 | 52-495 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.