DPCstruct | MC21304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 127 ± 25 aa |
| Standard deviation of domain lengths | 25.12 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084G6P8 | 7-116 | LDDRRDYDDAQRGFIAALTPGIIKNAKGEVVWNIDEYAFLEKDCPPTAHKHLWRQAQLIAKQGLFEIKPGIYQVRGLDLSNITIVEG… |
| A0A516R260 | 3-123 | QPVEASSSVAEANRKRAACAPPDADDFEDATRGRLAIPPLSAIPSRAPGGRPVWDFTGHAFLHRRDTPPPSVNPHLWRRSRLAAITS… |
| C9RPJ4 | 1-172 | None |
| A0A854GZ31 | 5-112 | None |
| A0A828ZQD6 | 1-88 | None |
| A0A1C4TDK9 | 2-87 | None |
| A0A7K0CWG2 | 4-97 | None |
| C4JKA3 | 9-114 | None |
| A0A2C6YLS1 | 23-180 | None |
| A0A352S7J9 | 252-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.