DPCstruct | MC21302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 71 ± 9 aa |
| Standard deviation of domain lengths | 9.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6APJ7 | 2-67 | IESIKNQILNHLNKEVKVVSKENRNKTDIFYGNITEIYSHVFIVDNGIEKRSYSYSDILSNDIFMT |
| A0A6A8LZG3 | 9-83 | VDDIHEKLTDMVGDRVKVKANMGRTRVVERMGTIKSVHPAVFIVEVDERRGRKSRQSYQYIDVLTGQVELFDPES |
| A0A3N0IIL2 | 8-88 | None |
| A0A0R2G0Q5 | 2-63 | None |
| A0A1T4P7H9 | 25-96 | None |
| A0A0L0RKM1 | 2-61 | None |
| A0A1V5HXV1 | 2-63 | None |
| A0A140LBB9 | 7-83 | None |
| X1BSE2 | 12-82 | None |
| B7RAF2 | 2-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.