DPCstruct | MC213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 9.01 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A562PHK6 | 115-181 | AEPASPIGSVMMLKDRTLVMDLRAETGGAVGHGQFVYTPNDAEYAGIVKHVGGLKPGEEKPVPPFVD |
| A0A1F4U7D7 | 13-93 | IIILLSSGCKVKGGDSVVNSIGEATMLQDGTIVLNLRGQGEGGMKGDAQLSYPKNHQNYNEILKHLDGLKPGESKPVPPWE |
| A0A0Q5D543 | 178-254 | None |
| A0A520CRV6 | 6-103 | None |
| A0A7Y9IXA5 | 2-76 | None |
| A0A2W5YSD0 | 59-141 | None |
| A0A4Q3HI95 | 1-83 | None |
| A0A7Y5FK32 | 146-213 | None |
| A0A4Q5Y685 | 221-286 | None |
| A0A3Q9JH68 | 127-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.