DPCstruct | MC21299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 102 ± 16 aa |
| Standard deviation of domain lengths | 15.84 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061A3E3 | 1-86 | MHLEPDVAFGSIPEFGIAAAVADDRLFLDEVLRKHHFEYKAGLDVYLLPPEIPHNAAVKNVAAATREFQDAGLSVAADPRAVVPPD |
| A0A2X0KGJ7 | 11-97 | MARPDEPVVNICRHECTGTTAQGHDPLVSLLLRRAGFITEDYFHQRYRRLPYDLSDGVAERMATNAARMLRACHYQVRIDADLDLDA |
| A0A640SL36 | 26-130 | None |
| A0A7H8KWY9 | 26-148 | None |
| A0A7W3T7E2 | 58-143 | None |
| A0A1H0SGS7 | 40-170 | None |
| A0A852ZM14 | 114-223 | None |
| A0A640TSA4 | 23-134 | None |
| A0A1H9WGV9 | 8-109 | None |
| A0A117EAB2 | 5-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.