DPCstruct | MC21295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 13.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.45 |
| Pfam Score | 90.54 |
| Assigned Pfam label(s) | CL0036- PF12972 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D3FIN0 | 204-317 | MIVLDLFADVKPIWQMSSQFYGVPYIWCMLHNFGGNIEMYGILDSIASGPIDARTSHNSTMVGVGMCMEGIEHNPVVYELMSEMAFR… |
| A0A5N7CPV7 | 1-114 | MLILDLFSKSEPQWQRTKSYFGKPWIGCQLHDFGRNMGLYGQIMNVTLSLIDALESPDSLVGFRLTMEGQEENEIIYDLLLVQAWSA… |
| F2UT44 | 545-665 | None |
| A0A6A4VE68 | 346-441 | None |
| A0A835IQU3 | 10-107 | None |
| A0A7R9AWU4 | 157-251 | None |
| A0A6J0PLB7 | 237-350 | None |
| A0A1Y1NFQ6 | 378-504 | None |
| A0A2E3MTX5 | 400-528 | None |
| A0A4S4DES6 | 87-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.