DPCstruct | MC21291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 164 ± 31 aa |
| Standard deviation of domain lengths | 30.97 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02107 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4ZFY4 | 1-74 | MSVAAVITQVLPDGRLAIEGRRAAQIGGAVVEVAIAGVIRSQDVGNGKTIDASKIAQARIWSRWRGNTDAQRQG |
| A0A7C7NNE6 | 2-153 | GDIVYIIVYESIDAVQKLATQTGQQHQIANAINSFFGIHPKTLQNLGVDWQYKSSSKYSGSTQQSGVLSTRLAAYVKKVYPNGNLLI… |
| A0A2W4LN24 | 188-373 | None |
| A0A3D6D9U4 | 8-119 | None |
| A0A7C5CBL8 | 4-102 | None |
| A0A7C7RP73 | 5-133 | None |
| K1YC33 | 9-171 | None |
| A0A7R9IUK8 | 18-192 | None |
| A0A7W2BH73 | 12-160 | None |
| A0A2D6CTV2 | 2-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.