DPCstruct | MC2129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 136 ± 16 aa |
| Standard deviation of domain lengths | 16.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B9LQU0 | 1-167 | MSFVNAYVSNEDAKKYDLDNLWNKYNPWFTQMPELLKSFDVHQHAWCVDKERGYWLFNCGWVLNYDSPSGLPEPTNKQVFILHVNGQ… |
| A0A2D9DRZ4 | 3-140 | FINEIIPESEKDKLPFKVDTRANGYKPTLWEWTRDRDRSACVVHTSSSNGVDGTPPEDTYVMIWRDNLVSFAGYPTFSKDRRTRNWN… |
| A0A2R7QXM0 | 2-132 | None |
| A0A139P6X5 | 15-120 | None |
| A0A7R6SSJ5 | 1-146 | None |
| V2YAM3 | 39-191 | None |
| A0A167HTW4 | 14-166 | None |
| A0A0L6JII7 | 152-275 | None |
| A0A430ABR9 | 3-115 | None |
| F2BRH5 | 63-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.