DPCstruct | MC21288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 140 ± 22 aa |
| Standard deviation of domain lengths | 21.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7EP64 | 78-205 | WELAYIPSQSDAVKTITETARRTLVINMRARGFRSENDFEDYIKYDNRSSNVLAAVVFEHAFNHSRDPLPLAVKYHLRFSYTRRNYM… |
| H2XS45 | 66-193 | LFSNQNLVANNTLFYVAPQFAEAELLINTIEGFSPMSPKNLTVTYFNTLLEMETAYKANSVLNPIGIFFPNKSIDDYMLRFPFTSLP… |
| T1GC86 | 9-173 | None |
| A0A1Y3NSV7 | 36-158 | None |
| A0A814EL52 | 59-217 | None |
| A0A132A7K0 | 32-169 | None |
| A0A2U3ZWG1 | 49-224 | None |
| A0A5B7IYG7 | 1-132 | None |
| A0A2I0TAN0 | 167-293 | None |
| A0A6J3C1L0 | 92-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.