DPCstruct | MC21287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 166 ± 9 aa |
| Standard deviation of domain lengths | 9.19 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4QM17 | 1-179 | MRASKFYEYYVKYHAPFGDVLRCSMELALQRNPIHFAMTMLHTCLLLYAKSFPDDTRKAAEQRALKPAEFSELMAVANRLAKILISH… |
| A0A437BLM0 | 155-315 | RAADVFKHYIKCYNDYGDIIKATVSKAREISKLSCALTMELAMQALFADMLSKHPAPNRQLPEFLELKELAKRFSVMFGLDAVKNRE… |
| G3I5G1 | 121-288 | None |
| A0A183RHF2 | 1-151 | None |
| A0A2D4F1C7 | 40-221 | None |
| A0A4C1TPA2 | 84-251 | None |
| A0A4W5MMD0 | 151-317 | None |
| A0A5E4AUX2 | 3-170 | None |
| A0A811Z8J8 | 186-332 | None |
| A0A834C756 | 2-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.