DPCstruct | MC21286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 250 ± 78 aa |
| Standard deviation of domain lengths | 78.15 |
| Length coefficient of variation | 0.31 |
| Mean AlphaFold2 pLDDT confidence score | 82.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J0M5J7 | 299-496 | LSVSFKEQMSDTTSNWIVVGVRFIEDSHMVHIQILEGLVSAYGEISMTRWRKVEENGDFVTLKEGKENGHVKKINLGDVVAPLEYVV… |
| V5GA77 | 34-257 | RYFNMRPVMADVAHNRVVTGLRIVKHNRIIHLQIQEGKLLPYGYIDDSTIRWVPVDDYTITDDGVQNGVDFHVMDYERRTLFLDDLM… |
| A0A4C1TDY9 | 39-244 | None |
| A0A1W5ICN0 | 324-518 | None |
| A0A5E4Q8A6 | 440-798 | None |
| A0A4C1W7E9 | 110-421 | None |
| A0A834XMP7 | 377-768 | None |
| A0A834XN33 | 841-1057 | None |
| A0A7R8X3Y9 | 242-441 | None |
| T1GAB5 | 2-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.