DPCstruct | MC21285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 203 ± 30 aa |
| Standard deviation of domain lengths | 30.29 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 50.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5Q5F0 | 172-322 | VLDVVLPVERHVRANVAVYYDDILLAYANQQWRVGLPPWTKDSPEYVAIKERIYELLLQHRFCAYDLPVPLTSPAADRWYRDPRVHS… |
| A0A2K3LCN9 | 1-188 | MEEDAISSLSLRLKLNLTVWEFVLPETPSLPAVFGISDTVIEDRFGVKHGTAEWYEALDQHFKWLLQYRISPYFCKWADGMRVLTYT… |
| A0A287HQ06 | 129-356 | None |
| M0XKG4 | 1-223 | None |
| M0XKF8 | 1-229 | None |
| A0A7C6DD88 | 394-551 | None |
| A0A3Q7GB12 | 82-302 | None |
| A0A0E0EDM1 | 164-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.