DPCstruct | MC21282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 143 ± 23 aa |
| Standard deviation of domain lengths | 22.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.16 |
| Pfam Score | 93.42 |
| Assigned Pfam label(s) | PF03791- PF03790- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1QHB1 | 4-121 | GGEADAARCKAEILAHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQGVVAKYSALAAAAAGDDGRELDQFMTHYVLLLCSFKE… |
| A0A2K3LBP0 | 2-130 | HNHHQGGGGGSPSSSSNEAEAIKAKIIAHPQYSSLLQAYMDCQKVGAPPDVVARMVAARQEFEARQRSSVKSRENSKDPELDQFMEA… |
| A0A6J1BR77 | 51-233 | None |
| A0A067JLR5 | 10-124 | None |
| A0A835RUI9 | 28-263 | None |
| A0A0A8Y0L7 | 20-208 | None |
| A0A7I4C370 | 217-342 | None |
| A0A834TXQ5 | 47-200 | None |
| A0A438DV37 | 110-263 | None |
| A0A445D1H1 | 41-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.