DPCstruct | MC21281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 96 ± 6 aa |
| Standard deviation of domain lengths | 5.97 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1PM04 | 273-368 | QQLVNWCGGEEFDGCLVFDECHKAKNFVPGKEQASTKVALAVTTIQRLLPKARVLYCSATGVTDVKNMAFMERLGLWGVGAQFRSFE… |
| A0A2K3L9N1 | 5-94 | VQWCGSKFDGLIIFDECHKAKNLVPEKGKKSTRTGEAVLDIQAQLPEARVVYCSATGASEPRNMAYMVRLGLWGVGTFFSDFGEFHG… |
| R7U7D3 | 139-234 | None |
| A0A250XPB5 | 193-287 | None |
| A0A5K4F5D8 | 345-435 | None |
| A0A8B6DDH6 | 532-626 | None |
| A0A2A2M333 | 331-436 | None |
| A0A852Y3K7 | 311-410 | None |
| B4DL53 | 317-412 | None |
| Q0FH07 | 569-667 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.