DPCstruct | MC21276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 162 ± 37 aa |
| Standard deviation of domain lengths | 36.78 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.13 |
| Pfam Score | 94.55 |
| Assigned Pfam label(s) | CL0229- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9C5F5 | 1-134 | MWLCSHAEPRPHSSFYVYCKSVCRAIQPGKLRVRCRACKQGTLTLSREFYLKCAAHPTSDDDTSVALDLVMPNVRDVPCIACTDIMS… |
| A0A673CJC8 | 7-98 | SDGCHGNEAEFYMKCASHPTADDDLSVALDLVMTNTRNVPCIACTDVMDVVVVFQCPERHVICLDCFRRYCQTRLNERQFVHDAVVG… |
| F1L7D7 | 84-244 | None |
| A0A3P8E1X8 | 84-223 | None |
| A0A3Q4H617 | 99-284 | None |
| A0A7S1F212 | 1-145 | None |
| A0A0K0DFB5 | 40-218 | None |
| A0A0G4ILL5 | 1-167 | None |
| A0A2T7P4M7 | 94-283 | None |
| A0A3M6T651 | 82-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.