DPCstruct | MC21275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 6.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 67.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W3JHA5 | 58-128 | MDYDFKTKLAAEREKVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDEKEYALKQIEGTGISMSACREIANIT |
| A0A6F9C3K1 | 1-69 | MDYDFKTKLAAEREKVEDLFEYEGCKVGRGTYGHVYKAKRKDGEDEKEYALKQIEGTGISMSACREIAV |
| A0A4U5NFA8 | 69-146 | None |
| A0A4U5NG54 | 2-73 | None |
| A0A2H1BV15 | 60-128 | None |
| A0A336M8V5 | 1-69 | None |
| A0A817D840 | 1-75 | None |
| A0A672RTD6 | 1-85 | None |
| A0A3B4B7X8 | 1-61 | None |
| A0A232EHL3 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.