DPCstruct | MC21273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 217 ± 11 aa |
| Standard deviation of domain lengths | 10.53 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 69.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7FSX3 | 326-544 | CLERQEAGADCCNNARTDDCKSACVDLFRRELSPTKLQRQKVKDYCENDSPRVTDCVKDLIKVTPVKNIHKHIHCCDKSNIIKCRES… |
| A0A6F9BYT0 | 18-204 | SVCAVSVGSVCCSYAGRHTNCREYCQAIFRTDSSPTVSQIKAVKEYCQSISPELIGCVGNYTMSYPIRSPIDKHEIMEGLIDECGSQ… |
| A0A7J7JD80 | 139-363 | None |
| S4RSB7 | 48-281 | None |
| A0A0S7KGP4 | 2-210 | None |
| A0A0S7KFP6 | 1-216 | None |
| U4UAR1 | 53-273 | None |
| G3IB55 | 1-216 | None |
| A0A3Q0IM12 | 93-315 | None |
| A0A498LF10 | 137-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.