DPCstruct | MC2127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Standard deviation of domain lengths | 9.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.46 |
| Pfam Score | 83.93 |
| Assigned Pfam label(s) | PF03247- PF01352- PF09514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5G2R6D2 | 13-95 | EDAQKSEKKSKAFNDISKYFSKEEWAKLGYSEKITYVYMKRNYDTMTGLGLKATPPTFMCPRKQTIESSGHDSEDQDEPPKEA |
| G1QTT6 | 1-98 | MNGDNDCAKRARDDAQIPEKIQKAFDDIAKYFSKKEWKMKASEKITYVHLKRKYEVMTKLGLKVTLSPFMHNKWAADCQGNDFVKDR… |
| A0A7J8AVC6 | 1-100 | None |
| A0A6J0Y5J4 | 1-96 | None |
| Q80ZT4 | 1-97 | None |
| A0A6I9JRI7 | 17-109 | None |
| L8YB62 | 13-141 | None |
| Q8C5Z3 | 38-132 | None |
| A0A2R9B8S0 | 1-100 | None |
| M0RBX4 | 39-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.