DPCstruct | MC21269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 216 ± 35 aa |
| Standard deviation of domain lengths | 35.07 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.05 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0023- CL0116- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496LWG6 | 62-234 | AVVLVATIRALKMHGGVAKSDLAEENVQAVVDGLPNLEKHLENIQDVYGLPAVVAINKFPLDTEAELQAVYDACQKRGVDVVISDVW… |
| A0A6F9BVL4 | 95-286 | VLVATNMSLVAEGCSSNLRKQIQIAHLFGVPVVVALNVFKTDTQAEIDLVCQMAKESGASDAVPCHHWARGGRGSVELAQAVKQASS… |
| A0A6U0RF96 | 2-168 | None |
| A0A7J6SQD3 | 98-340 | None |
| A0A3D4ZYS0 | 307-548 | None |
| A0A553MV03 | 676-901 | None |
| A0A7C7W6G1 | 44-283 | None |
| A0A6G0XHM6 | 416-656 | None |
| A0A5A9NF52 | 1039-1280 | None |
| A0A5B8MY87 | 15-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.