DPCstruct | MC21268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 153 ± 17 aa |
| Standard deviation of domain lengths | 16.84 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9BUY8 | 1-138 | MTRSASGPRSRWVESGIPEAYEIKVYEIDDVERLQRRGGAGKQGIACFSAKLKFLEHRQQRVEAVRAKYNSLKTELELAKQNLRLEP… |
| A0A6P6NDH1 | 3-126 | GAMKEPFEIKVYEIDDVERFQRRKEGLTEGLQYFNARLRMLEKRQQQIRELRAKHEKLKKELEDAKTHLMLDPSKWMGEFDVDPDLD… |
| A0A7R8XBW3 | 284-425 | None |
| A0A087VYW6 | 676-848 | None |
| V3ZWY9 | 953-1124 | None |
| H3C572 | 911-1045 | None |
| A0A4Z2J1N0 | 1-179 | None |
| A0A182E8K5 | 10-160 | None |
| A0A5N4E2H7 | 1-141 | None |
| A0A2R2MKQ4 | 883-1039 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.