DPCstruct | MC21267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Standard deviation of domain lengths | 4.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 72.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4KDP0 | 65-120 | QGKIGVKFNVGTDDISIEEINAIINDGKYHVVRFTRSGGNATLQVDNWPVIERYPA |
| A0A6F9BUP9 | 21-86 | STSRLQCTEGKVGVTFNIGTVDISVKELTTAINDGKYHLVRFTRNGGNATLQVDNWPINEHFPTGR |
| Q4T5A3 | 3-65 | None |
| A0A1L8F0F7 | 1-56 | None |
| M7CGF9 | 66-133 | None |
| S9WPE5 | 5-71 | None |
| K7FQQ7 | 150-205 | None |
| A0A4W5RR61 | 1-57 | None |
| A0A4W5Q5M6 | 2-68 | None |
| A0A0P7THK9 | 8-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.