DPCstruct | MC21266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 189 ± 15 aa |
| Standard deviation of domain lengths | 14.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484CCJ9 | 1-185 | MLELNSERAKVLVDEILHSIFFLGKINDPQHPPESIVTDTEMLDGLKIIYPRPFDHYSSQLPKRSPFSCVLDMIVLLTGEENEEEIK… |
| A0A6F9BH43 | 1-194 | MNKLLHSIFLLGHIHKDSLPPTAFFESPEGRLVMSDLEVRFRHPFKHYKSKLPNQAPFSFLQDLAVEICGHEEEEGIKIFALDFLNL… |
| A0A6A5EEX1 | 1-221 | None |
| A0A5N5J6U3 | 47-217 | None |
| A0A4D9EBX3 | 113-300 | None |
| A0A4U5VKT3 | 213-397 | None |
| A0A2D0S2G4 | 98-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.