DPCstruct | MC21265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 154 ± 10 aa |
| Standard deviation of domain lengths | 10.47 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9BEJ0 | 1-154 | MTVLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKDVGLALRTLLATVDETITLLPASTHREVEMAQ… |
| B0XFS9 | 325-462 | KKAEPSRTMPLDRTGDVVYSATTCVVKSIMALSQGVDKSQAAEYLDLVRNVGIELRTLLGAVDTISVSFPAQCHKEVEMAHKVLSKD… |
| A0A034W2L1 | 276-429 | None |
| A0A7R8CUE1 | 236-395 | None |
| A0A1A6HTD4 | 471-607 | None |
| A0A2I0T7B2 | 150-321 | None |
| B8A418 | 932-1085 | None |
| A0A7R9QBS4 | 151-299 | None |
| A0A182GDL0 | 142-306 | None |
| A0A0M4E7E7 | 940-1093 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.