DPCstruct | MC21263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 120 ± 14 aa |
| Standard deviation of domain lengths | 13.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14720 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0S7Z0 | 25-147 | RAAFYEQGNFATEYGSDHRCLVKLGCKGPVVKCNVPLRGWQSGIGGCPNVGGICMACTMPGFPDKYMPFMDEDANAKLSSNLAKFTY… |
| A0A7C1JJ87 | 2-110 | FATQPGELGCMHRLGCKGPVTYADCPQRQWCGEYTNWPVGANTPCIGCASPAFPDGVSPFFEHLPDFKAPFSLPAERAGLLTGALTA… |
| A0A2Z6TKL4 | 236-344 | None |
| A0A7X7N1G6 | 180-304 | None |
| A0A4R5EGL8 | 205-327 | None |
| A0A6C8GNZ1 | 1-85 | None |
| A0A7V8BGI9 | 8-142 | None |
| A0A7J3S0I4 | 188-311 | None |
| A2BMI5 | 399-502 | None |
| A0A7I9W1Q2 | 106-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.