DPCstruct | MC21262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Standard deviation of domain lengths | 11.79 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A4VJV9 | 1-90 | MTYVVETYDAFDAPPERRHLVVGRFNTTDKALKCAKNVVDSYLRNELSKGKSLAEAGMMFSCHGEIPMIFGEPEIDFNAFDYADART… |
| A0A847XLW7 | 4-95 | KQKYQIFIDDNFHYMDGDYRSPRGGYDTLEEAISICKDIVDGYILSLDYQNSSFDQLWGQYTAFGEDPWISGPVEGIPFSAWDYAKN… |
| A0A3P3XSE0 | 1-98 | None |
| A0A521K724 | 89-186 | None |
| A7NG55 | 2-93 | None |
| A0A191UGG6 | 8-95 | None |
| A0A6J7GN02 | 3-93 | None |
| A0A7C3IRI0 | 2-93 | None |
| A0A2N6E5I4 | 3-70 | None |
| A0A7Y5BGY3 | 18-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.