DPCstruct | MC2126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 473 ± 84 aa |
| Standard deviation of domain lengths | 84.15 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B1QZZ9 | 8-411 | VVTWQARVEEALGHWDVEAAVRLLRERPGEFLRRLDLLLARSGSTTLPDTVGEALADVLPRSGPGPLLGAYGRMKVRAVPGHRRVFF… |
| A0A3N0AWU8 | 17-450 | VKYLSLKRFAMPDDHERIMAAVNGKVPSWNARAEKLWSRIDALNAATGACATLSGSGAASEGELDAIHQDITQQREQAMRDLLMFYL… |
| A0A507ERL5 | 350-818 | None |
| A0A1H1GUN9 | 1-556 | None |
| A0A7Z0TH74 | 2-388 | None |
| A0A563VYI6 | 25-441 | None |
| A0A507FQ17 | 580-956 | None |
| I0GSG4 | 240-636 | None |
| A0A7T4U0C4 | 117-655 | None |
| A0A1F1GQ75 | 213-880 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.