DPCstruct | MC21255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 163 ± 18 aa |
| Standard deviation of domain lengths | 17.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R2SLN3 | 216-376 | LSTDWANDYLLEGLNRLMTPRDRDRFYAASTDDKLPRELRQTLYFDEVDLLWDKNLRAFRSQGALGVGGVSGNAVHRYVEGVLELRK… |
| A0A0S8JXY4 | 24-174 | RDRTEKYQTELGLYGEYQSSVPELTHTLFFAKVKLVWHQESRSYRSAGKISLASINGDQINKQLDGYMEFTKRRNGDMVDIYLELDR… |
| A0A1V5NIF7 | 24-195 | None |
| A0A7X6PFW2 | 389-569 | None |
| A0A7Y6XNN9 | 7-138 | None |
| A0A2E2QE67 | 118-286 | None |
| A0A2N5YST3 | 41-218 | None |
| A0A662A4U2 | 971-1143 | None |
| A0A7W1PUV6 | 252-429 | None |
| A0A3E0QX69 | 461-628 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.