DPCstruct | MC21254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 73 ± 16 aa |
| Standard deviation of domain lengths | 16.00 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R7UZ05 | 147-237 | EAGAIAYLFNIDDSQIDHMVYPKDLVAYARSNTPKHNTPGPVHAGQPCPHTGYWFSPAQHNSRRHFTQGEIMPEFKDSPWGATIWYW… |
| A0A7W4T1Q1 | 12-100 | AIAFLYGIEDSKINHRVYPKGLVEYARNYQPTDTAQIARINAGQPCSKAGYWFTPAQAESRRYFEQGEIMPSFSDSRWGDTIWYWSG… |
| A0A1H7ESI5 | 13-103 | None |
| A0A0M4LDX1 | 167-235 | None |
| A0A0Q4Y482 | 39-99 | None |
| A0A0A0EYK4 | 53-125 | None |
| A0A0N8TD81 | 109-178 | None |
| A0A4R6DWG6 | 259-314 | None |
| A0A2N0ZT64 | 287-368 | None |
| A0A6H3TTK2 | 224-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.