DPCstruct | MC21250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 92 ± 5 aa |
| Standard deviation of domain lengths | 4.93 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 71.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 61.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A699HW28 | 1-101 | MDADEDVTLKDGAAVAKKMKEEDNKALKRASESQAEKAAKKQKLDEEVEELKKHLQIVPNNKDDVYTEATPLARKVPIVDYEIYIEN… |
| A0A6L2M2J6 | 173-264 | QRLDYFKKQIDEEERRATESINKTPAQKASKRRKLNKEVAELNKHLEIVPDEDNDVFTEATPLARKVPVVDYSIIFLNNKPHYKIVK… |
| A0A6L2J6L6 | 211-304 | None |
| A0A699SL44 | 1-86 | None |
| A0A6L2KHV7 | 146-232 | None |
| A0A6L2MFT7 | 140-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.