DPCstruct | MC21249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 235 ± 30 aa |
| Standard deviation of domain lengths | 29.86 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 66.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A699HN94 | 11-216 | SGSSRTLGKHRVLVCYNCKGEGHMSKQCTKPKRKRDEAWFKDKVLLVQAQANGQVLQEEELELLADPGIAKTSSTQYVVTNNATYQA… |
| A0A699L5T3 | 1-200 | MSTGSSRPFVSGSGGTSGKQRVIVCYNCKGESHMSKQCTKPERKRDAEWFKDKVLLVQAQANGQVLQEEELDFLADPGTVESSSNQT… |
| A0A699GN40 | 41-302 | None |
| A0A699IQL1 | 42-300 | None |
| A0A699IQ31 | 1-190 | None |
| A0A6L2JEV6 | 250-490 | None |
| A0A6L2P0C6 | 107-331 | None |
| A0A6L2NJG1 | 106-345 | None |
| A0A6L2NAE7 | 1-207 | None |
| A0A6L2LTC2 | 161-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.