DPCstruct | MC21247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 214 ± 23 aa |
| Standard deviation of domain lengths | 23.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S6XJU4 | 7-253 | IYRAWQNTPRPIIYHTADGKGNPIDTECNFLDPLKHPKYDAEWNGNCLICGAPSHGGIPYKALLGSSYTDWSRHKCPESNHICPACA… |
| A0A0Q5HPU0 | 42-276 | PTAFTARIIGLRAPTEPTSEPSCWLCAGDLDGQGVPLADVIGAAFTDHPRRHQSTHVCLGCAATVKVAEFQRVVSERGMGLKIWAQA… |
| A0A7C3YQL7 | 5-245 | None |
| A0A5Q5BTF5 | 66-262 | None |
| Q5NWN9 | 3-248 | None |
| A0A662HFN7 | 5-187 | None |
| H0R612 | 1-171 | None |
| A0A1V5VVK6 | 8-225 | None |
| A0A2A4IQT8 | 28-228 | None |
| E1R3I9 | 15-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.