DPCstruct | MC21245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Standard deviation of domain lengths | 8.90 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D1JL78 | 1-103 | MNQDVKLNVFEAFSGVGSQHMALRNINKKFKIVATSDIDPAATLAYYYIHKKNDNSYNILPKQEIINYLSKILIKSEKDLKKLSNEK… |
| A0A449B6J4 | 1-117 | MTIKVFETFAGIGSQHKSIKNINSKNEDIKFDIIATSEWDARCIIAYSAMHNKLNEETIEKTLKANNLLNEDQINEYLLKNVFSLNS… |
| A0A7C6P3Q3 | 3-110 | None |
| A0A0H3XI62 | 1-85 | None |
| A0A843H7H7 | 20-122 | None |
| A0A449A9I4 | 3-115 | None |
| A0A7X9EDR0 | 15-123 | None |
| A0A654IKP7 | 3-108 | None |
| A0A350S1T2 | 18-120 | None |
| C5J770 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.