DPCstruct | MC21238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 163 ± 19 aa |
| Standard deviation of domain lengths | 19.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01862 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497N863 | 1-158 | MPKKFFVTGGCAVSSVSPLNAFDAALVKAGIAQCNLVPVSSILPPDAEKVEPVEITPGTVTFCVMARMDGDPGERIGAGIGWGWAEK… |
| A0A523XEY5 | 3-178 | NPTRFWLTSGIGESDTSELDAIDKAFMNSGLGYQNHIAVSSIPPVVEIIPEIDRAKGITFIEVDDKCIMIPFSTNIHVVKSLSKGSV… |
| A6Q8N2 | 25-215 | None |
| A0A842ULK4 | 2-138 | None |
| A0A6L7F2G3 | 17-174 | None |
| A0A1H1XCR3 | 21-181 | None |
| L9ZAQ0 | 2-123 | None |
| L7VYL9 | 71-229 | None |
| A0A2R6WXH2 | 179-372 | None |
| A0A5E4K269 | 15-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.