DPCstruct | MC21237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 14.27 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497QW86 | 9-119 | KPFWEIFGKADLDEELGLLTLTTPAGEVVTMSADGAITAKGKTIKGVKTALKNLVLEVFRTEDCTGCKVCLSHCTANALFINPTTNQ… |
| A0A7J4DQP9 | 11-132 | NLDSKPLAEQAPVLGKSCSVGGEGGRVVVETPIALYSFDGVRLEVVGKHVHGDRLLEEAFDALKIVYRGNYCVDCLSCESNCPRGAI… |
| A0A1I0NEZ1 | 394-510 | None |
| A0A7C4B508 | 593-714 | None |
| A0A7C4F8Y6 | 488-603 | None |
| A0A7C3MJL7 | 171-293 | None |
| A0A523RZW3 | 134-243 | None |
| A0A849QC31 | 5-109 | None |
| A0A7C4H680 | 3-136 | None |
| A0A7C4B7C9 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.