DPCstruct | MC21236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 196 ± 21 aa |
| Standard deviation of domain lengths | 21.05 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 19.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7DRC6 | 2-156 | QLDFSIRVPRVPWNDDKRIFLCCLHKFFERDSTAFKEIFNAKYRRDLENSGFTDGRTSSSTLDSQWGDMRRLGDPIWGRVHKAPLNH… |
| H6BNH9 | 1-184 | MDEDTVTILNNQNSPKHAWTPEDRRTLSLLTKLYNVSKADMRLIFNQMFRRRLQHEGFSEGVSLTTIRSQVAHLKRIGMGEYQAIQS… |
| A0A438NDP9 | 1-190 | None |
| A0A0U5GSN1 | 1-198 | None |
| W6PRW7 | 1-227 | None |
| A0A150V675 | 1-187 | None |
| A0A2B7XX13 | 3-222 | None |
| A0A6A6VXR0 | 83-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.