DPCstruct | MC21235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 4.07 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 94.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 47.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00374 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G6CA24 | 362-421 | NDHPMPMEAEGVGFADVPRGALSHWIKIKDGKIENFQLVVPSTWNLGPRCDKGKLGPVEE |
| A0A1G1FVL7 | 134-199 | AVYNDYQIPDKAQGIGLWEAPRGALGHWIDVDGKKIKNYQCVVPTTWNVCPRDDNGVRGPIEEALI |
| A0A660UQG8 | 17-82 | None |
| A0A7Y5LA15 | 42-110 | None |
| A0A2X2Y7G8 | 198-259 | None |
| A0A2C6MB42 | 1-69 | None |
| A0A7V5I042 | 162-228 | None |
| A0A090QWM5 | 192-259 | None |
| A0A1V5MYI6 | 22-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.