DPCstruct | MC21232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 280 ± 39 aa |
| Standard deviation of domain lengths | 39.49 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U8RSP3 | 7-267 | KWTQAAMLEEYKKVVNSGDGDAVKGDEAGRQATGKEGKKWIGGQQRGGAGQPAIRPVHDLTAAGFNMMNGLPVTSTASVSAGNCNGS… |
| A0A484S5S2 | 248-503 | QMGWNQIAEGMALRQAVASTDAVSAIEQAETSRGNDGVPWVGGNNADGAGQSAIRVVGDVTRAGYNLVNGRGVSDSSAIATASCTTL… |
| A0A839TA60 | 47-352 | None |
| A0A379B8M8 | 161-452 | None |
| A0A2E6H6M7 | 98-419 | None |
| A0A379F614 | 134-459 | None |
| A0A2X1PVG9 | 11-264 | None |
| A0A0N0FV61 | 150-343 | None |
| A0A378APM1 | 1-259 | None |
| A0A660ML98 | 191-439 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.