DPCstruct | MC21231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 180 ± 25 aa |
| Standard deviation of domain lengths | 24.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20597 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4DHL8 | 29-174 | EGGDVYSDVGDNLGELGIASRFHIFAENSVEVNAHVNGNIASNHFFANSNFGTDIREGILKQEIVYLNKIHSIVSSSFVEETNQRST… |
| A0A4Y3JM82 | 33-227 | DPGNIYNDLTGNYGLLGIASQFHVFAKNKTTVNAHTDGNIATHELDAKNNFGTELHEGLLNQEINYIQKTDSFANSSGIPTGSTRMN… |
| A0A5A5U3C7 | 25-208 | None |
| A0A0G8G6P6 | 79-309 | None |
| A0A5P9QGJ4 | 112-271 | None |
| A0A251WP08 | 1-190 | None |
| A0A8B5R110 | 6-161 | None |
| K1MHF6 | 75-235 | None |
| A0A2R3JVY9 | 168-326 | None |
| A0A5C8JKM2 | 2-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.