DPCstruct | MC21229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 122 ± 25 aa |
| Standard deviation of domain lengths | 24.66 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2BSB9 | 1-83 | MDVVKKYKIKRYINGELIEVDDDIVVEYLFTIYINEYEYITLICTPSSLLHLAVGFLYSDEIITSYNDINSINVFEKEGYVDI |
| A0A4V0ZSC7 | 176-289 | PNQRSIRRLRFANDEVTEGERVLPAETAVALSYNGSTQAVMMATPENLHDFALGYSLTEGIARSTEIERIEAVETPRGIDLQIWLAH… |
| A0A1V4GKZ0 | 3-80 | None |
| A0A3D1YVD6 | 130-271 | None |
| A0A4R3SZQ6 | 10-135 | None |
| A0A2V7JD37 | 131-268 | None |
| A0A661JKN8 | 2-82 | None |
| A0A842PA02 | 2-114 | None |
| A0A2M6ZRS0 | 948-1063 | None |
| D5EQE4 | 1-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.