DPCstruct | MC21225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 391 ± 67 aa |
| Standard deviation of domain lengths | 67.34 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 19.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06985 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A066WS93 | 3-421 | SEIGRQAKIFKGAAQTFVWLTKLSREEYQQQLGRECPTGSLADQARGCMDCARLQVEQLSQDPWFSSLWTLQEAYLCPRAVFITRDG… |
| A0A6A6IQB4 | 43-473 | AAEVGRQAAIFKGAQTVFIWMTTMPSDRSEHDFGNIDWLWLEPSQHTEETLPNVITAMLGFLDVLCDPWFSSLWTLQEAYLRPDAYI… |
| F0XPU2 | 527-958 | None |
| A0A132B2P2 | 520-770 | None |
| A0A1V6XY72 | 805-1247 | None |
| A0A0D2J434 | 99-574 | None |
| A0A3D8S6D3 | 444-742 | None |
| A0A5N6XDZ0 | 84-516 | None |
| A0A5N6YQT6 | 4-408 | None |
| A0A2P5HRT6 | 136-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.