DPCstruct | MC21223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 200 ± 11 aa |
| Standard deviation of domain lengths | 11.47 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 25.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A563EY60 | 216-407 | VISGGRFTPAGGRSGTLAFELADYSGHLVVRVEAGGDGVDRSIPITTREGTVEVFFDGLGGDGAPLPQSAPVVFEVLVERIAEIHFV… |
| A0A3N7GQB7 | 241-423 | TIGDLAFSRAVGGLGGTITGTLSGQSGTVRVLLDFDGDGTADPEDRAFDVATGVGAFSVNWDGLDGLGEPVPASTGFRVFVELTAEA… |
| A0A2E7USA6 | 211-401 | None |
| A0A5C6XQJ6 | 328-536 | None |
| A0A520IQ89 | 1-205 | None |
| A0A090WDM0 | 309-522 | None |
| A0A090PZG9 | 55-268 | None |
| A0A4Q3MEB0 | 254-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.